Chryseobacterium wangxinyae: PGH12_09925 Help Entry PGH12_09925       CDS       T11581                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cwg  Chryseobacterium wangxinyae Pathway cwg01100   Metabolic pathways cwg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cwg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PGH12_09925    00074 Mycolic acid biosynthesis     PGH12_09925   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PGH12_09925 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding DUF1493 ACP_SdgA_C PP-binding_2 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  WBZ93795 LinkDB All DBs Position 2156129..2156368 Genome browser AA seq 79 aa AA seqDB search MSDIASRVKAIIADKLDVEETEVTPEASFTNDLGADSLDTVELIMEFEKEFNIQIPDDQA EKITTVGHAIAYIEEVVNK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcagacattgcatcaagagtaaaagctatcatcgctgataagcttgacgttgaagaa acagaggtaactccagaggctagcttcacaaatgatttaggagctgactcacttgatacc gttgagttaatcatggaatttgaaaaagaatttaacattcagatccctgatgaccaagct gaaaaaattactactgtagggcacgcgattgcttacattgaagaagtagtaaataaataa

DBGET integrated database retrieval system