KEGG   Conexibacter woesei: Cwoe_0444
Entry
Cwoe_0444         CDS       T01153                                 

Definition
(GenBank) Glyoxalase/bleomycin resistance protein/dioxygenase
  KO
K00462  biphenyl-2,3-diol 1,2-dioxygenase [EC:1.13.11.39]
Organism
cwo  Conexibacter woesei
Pathway
cwo00361  Chlorocyclohexane and chlorobenzene degradation
cwo00621  Dioxin degradation
cwo01100  Metabolic pathways
cwo01120  Microbial metabolism in diverse environments
cwo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    Cwoe_0444
   00621 Dioxin degradation
    Cwoe_0444
Enzymes [BR:cwo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.39  biphenyl-2,3-diol 1,2-dioxygenase
     Cwoe_0444
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_3 Glyoxalase_6
Other DBs
NCBI-ProteinID: ADB48880
UniProt: D3F7A9
LinkDB
Position
454328..455290
AA seq 320 aa
MTPRLVKLGHIALSTPDLERSLWFFRDVVGLDEVERADGVVHLRAWGEREHHSLSLRAGE
TGVDHIAWRASAPGDVEAFAARLEAGGVAVERVPAGTEAGQGDAIRFSSPGGHPYEIYFD
VDRPPAAEEIRSRLGSSVSRMWRRGMSPRRIDHVNVAARDVDAGTEWLSQQLGMQLREFI
RPTGRGIVSSWMAVTSQVHDVALTRELAGRDGRLHHLAYWFDTRDDVMRAADIAVDQGLA
IDLGPGMHGVSRGFFCYLRDPGSGHRLELFTGGYQIYDPDWEPVEWTERDIREGLVWWGP
EYTPGRGHVFDETTPCGAAA
NT seq 963 nt   +upstreamnt  +downstreamnt
atgaccccccgcctcgtgaaactcgggcacatcgccctctcgaccccggacctggagcgc
tcgctctggttcttccgcgacgtcgtcgggctcgacgaggtcgagcgcgccgacggcgtc
gtccacctgcgcgcgtggggcgagcgcgagcaccactcgctcagcctgcgtgcgggcgag
accggcgtcgaccacatcgcctggcgcgcgtcggcgcctggcgacgtggaggcgttcgcg
gcccggctggaggccggcggcgtcgccgtcgagcgcgtccccgccggcaccgaggccggg
cagggcgacgcgatccgcttctcgagccccggcggccacccgtacgagatctacttcgac
gtcgaccggccgccggccgccgaggagatccgctcgcggctgggcagcagcgtctcgcgg
atgtggcggcgcgggatgtcgccgcggcggatcgaccacgtcaacgtcgccgcgcgcgac
gtcgacgccggcaccgagtggctgtcgcagcagctcgggatgcagctgcgcgagttcatc
cgcccgaccggccgcgggatcgtctcgtcgtggatggcggtcacctcgcaggtgcacgac
gtcgcgctgacgcgcgagctggccggccgcgacgggcggctgcaccacctcgcctactgg
ttcgacacgcgcgacgacgtgatgcgcgccgccgacatcgcggtcgaccagggcctcgcg
atcgacctcgggcccggcatgcacggggtcagccgcggcttcttctgctacctcagagac
ccgggcagcggccatcggctggagctgttcaccggcgggtaccagatctacgaccccgac
tgggagccggtcgagtggaccgagcgcgacatcagggaggggctcgtctggtgggggccg
gagtacacgcccggccgcggccacgtcttcgacgagaccacgccctgcggcgcggccgcc
tga

DBGET integrated database retrieval system