Cellulomonas xiejunii: NP048_05490 Help Entry NP048_05490       CDS       T09093                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism cxie  Cellulomonas xiejunii Pathway cxie00190   Oxidative phosphorylation cxie01100   Metabolic pathways Module cxie_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:cxie00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     NP048_05490 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:cxie00194]     NP048_05490 (atpE) Photosynthesis proteins [BR:cxie00194]  Photosystem and electron transport system   F-type ATPase [OT]    NP048_05490 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DoxX_2 Motif Other DBs NCBI-ProteinID:  UUI73710 LinkDB All DBs Position 1182249..1182479 Genome browser AA seq 76 aa AA seqDB search MILAAADAVSGNIATVGYGLAVLGPGIGLGILIGKTVEGIARQPEVAGQLRTTMFIGIGF VEVLGLLGLITGFLFQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgatcctcgccgccgctgacgccgtctccgggaacatcgcgaccgtcggctacggcctc gcggtgctcggcccgggtatcggtctgggcatcctcatcggcaagaccgtcgagggcatc gcacgccagcccgaggtcgccggccagctccgcaccaccatgttcatcggtatcgggttc gtcgaggtcctgggcctcctcggcctcatcaccgggttcctcttccagtga

DBGET integrated database retrieval system