Cellulomonas xiejunii: NP048_12505 Help Entry NP048_12505       CDS       T09093                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism cxie  Cellulomonas xiejunii Brite KEGG Orthology (KO) [BR:cxie00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     NP048_12505 Enzymes [BR:cxie01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      NP048_12505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 GST_N_3 Glrx-like Thioredoxin DUF3088 Thioredoxin_7 DUF1887 GST_N Motif Other DBs NCBI-ProteinID:  UUI70617 LinkDB All DBs Position 2749500..2749760 Genome browser AA seq 86 aa AA seqDB search MTTPTPAPGTVTMYSTTWCGYCHRLRKQLDSAGIAYDVVDIEQQPEAAQLVETLNGGNQT VPTIVFPDGSAATNPSLAQVRERLGV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacgacccccacacccgcaccgggcaccgtgacgatgtactccacgacgtggtgcggg tactgccaccggctgcgcaagcagctcgactcggccggcatcgcctacgacgtcgtcgac atcgagcagcagcccgaggctgctcagctcgtcgagaccctcaacggcggcaaccagacc gtcccgacgatcgtcttccccgacgggtccgccgccaccaacccgtcactcgcgcaggtg cgcgaacgcctcggggtctga

DBGET integrated database retrieval system