Synechococcus sp. JA-3-3Ab: CYA_0852
Help
Entry
CYA_0852 CDS
T00318
Symbol
accC
Name
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
KO
K01961
acetyl-CoA carboxylase, biotin carboxylase subunit [EC:
6.4.1.2
6.3.4.14
]
Organism
cya
Synechococcus sp. JA-3-3Ab
Pathway
cya00061
Fatty acid biosynthesis
cya00620
Pyruvate metabolism
cya00640
Propanoate metabolism
cya00720
Other carbon fixation pathways
cya01100
Metabolic pathways
cya01110
Biosynthesis of secondary metabolites
cya01120
Microbial metabolism in diverse environments
cya01200
Carbon metabolism
cya01212
Fatty acid metabolism
Module
cya_M00082
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:
cya00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00620 Pyruvate metabolism
CYA_0852 (accC)
00640 Propanoate metabolism
CYA_0852 (accC)
09102 Energy metabolism
00720 Other carbon fixation pathways
CYA_0852 (accC)
09103 Lipid metabolism
00061 Fatty acid biosynthesis
CYA_0852 (accC)
Enzymes [BR:
cya01000
]
6. Ligases
6.3 Forming carbon-nitrogen bonds
6.3.4 Other carbon-nitrogen ligases
6.3.4.14 biotin carboxylase
CYA_0852 (accC)
6.4 Forming carbon-carbon bonds
6.4.1 Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
6.4.1.2 acetyl-CoA carboxylase
CYA_0852 (accC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CPSase_L_D2
Biotin_carb_N
Biotin_carb_C
ATP-grasp
Dala_Dala_lig_C
RimK
ATP-grasp_5
ATP-grasp_3
GARS_A
ParB_dimer
Motif
Other DBs
NCBI-ProteinID:
ABC99056
LinkDB
All DBs
Position
860606..861961
Genome browser
AA seq
451 aa
AA seq
DB search
MPPITKILIANRGEIALRIIRTCQEMGIRTVAVYSTADQNSLHVQLADEAVCVGEAPVAK
SYLNIPNIISAALTRGATAIHPGYGFLAENAKFAEMCADHNLIFIGPSPEAMRKMADKAT
ARETMQAVGVPTVPGSRGLITSDEEAVRLAEKIGYPVIIKATAGGGGRGMRVARDAQELL
KMMRTAQGEAQAAFGDGGIYLEKYIERPRHVEFQILADSHGNVVHLYERDCSIQRRHQKL
LEEAPSPALTTSLRARMGAAAVKAAKAVNYVGAGTVEFLLDKNGQFYFIEMNTRIQVEHP
VTEMVTGLDLIAEQIRIAQGQPLTFRQKDVELRGHAIECRINAEDPKQQFRPCAGTISAY
LPPGGPGVRMDSHIYTDYTIPPYYDSLLGKLIVWGPNRAAAIRRMQRALGECAITGVPTT
IPFHQQILRHEAFLRGEVYTDFIAQHLLTGQ
NT seq
1356 nt
NT seq
+upstream
nt +downstream
nt
atgccgcccattaccaagatcctgattgccaaccgaggcgagatcgccctgcgcatcatc
cgcacctgtcaggaaatggggatccgcaccgtggctgtctactccactgcggatcagaac
tctctacatgtccaactggcggacgaagcagtctgtgtgggggaagccccagtggccaaa
agttatctcaacatccccaacatcatctcggcagccctcacccgcggggccactgccatt
catccgggctatgggttcttggcggaaaatgccaaatttgccgagatgtgtgccgaccac
aacttgatcttcatcggcccctcgccagaggcgatgcgcaaaatggccgacaaagccacg
gcccgcgagaccatgcaggcggtgggcgtgccgaccgtgcccggcagccgcgggctgatc
acctctgacgaggaagcggtgaggctggcggagaaaatcggctatcccgtgatcatcaaa
gccaccgccggcggcggggggcggggcatgcgggtggccagagatgcccaagaattgctg
aagatgatgcgcaccgcccagggggaagcccaggcggcctttggcgatgggggcatctat
ctggagaaatacatcgagcgcccccgccatgtggagtttcagattttggccgacagccac
ggcaatgtggtgcacctctacgagcgggattgctcgattcagcggcgccaccaaaagctg
ctggaagaggcccccagcccggctctgaccacgagcttgcgcgcccgcatgggggcagcg
gcggtgaaggcagccaaagcggtgaactacgtgggggcgggcacggtggagtttctgctg
gataaaaacggccagttctacttcatcgagatgaacacccgcatccaggtggagcacccg
gttaccgagatggtgacggggctggatttgattgccgagcaaattcgcatcgctcaaggt
caacccctgacctttcgccagaaggatgtggaactgcggggccatgccatcgaatgccgc
atcaacgccgaggatcccaagcagcagttccgcccttgcgctggcaccatcagcgcctat
ttgcctcctggagggccgggggtgcgcatggactcccacatctacaccgactacaccatt
cccccctattacgattcgctgttgggcaagctgatcgtctgggggcccaaccgggcagcc
gccatccgccgcatgcagcgggcgctgggggaatgcgccatcaccggggtgcccaccacg
atccctttccaccagcagatcctgcgccacgaggcttttttgcggggcgaggtgtacacg
gatttcatcgcccaacacctgctgactggccagtag
DBGET
integrated database retrieval system