Synechococcus sp. JA-3-3Ab: CYA_2874 Help Entry CYA_2874          CDS       T00318                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cya  Synechococcus sp. JA-3-3Ab Pathway cya01100   Metabolic pathways cya01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cya00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CYA_2874 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CYA_2874 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  ABD00974 CyanoBase:  CYA_2874 UniProt:  Q2JQZ8 LinkDB All DBs Position complement(2892183..2892428) Genome browser AA seq 81 aa AA seqDB search MSADEVYSRVRKIVSDQLGVEDDKVTLEANFQNDLGADSLDTVELVMAFEEEFDLEIPDE DAEGIATVQDAVNYILSKKAA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagcgcagatgaagtttacagccgtgttcgcaagatcgtgtccgatcaactaggcgta gaggacgacaaagtaaccctggaagctaatttccagaacgacctaggagccgacagcctc gatacggtggagctggtcatggccttcgaggaggagttcgatctggaaatccccgatgaa gatgcggagggcattgccactgtgcaggatgccgtcaactacatcctctctaagaaagct gcctag

DBGET integrated database retrieval system