KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2241
Entry
CYB_2241          CDS       T00319                                 
Symbol
oxaA
Name
(GenBank) inner membrane protein OxaA
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb02024  Quorum sensing
cyb03060  Protein export
cyb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cyb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    CYB_2241 (oxaA)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CYB_2241 (oxaA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CYB_2241 (oxaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cyb03029]
    CYB_2241 (oxaA)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cyb02044]
    CYB_2241 (oxaA)
Mitochondrial biogenesis [BR:cyb03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    CYB_2241 (oxaA)
Secretion system [BR:cyb02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   CYB_2241 (oxaA)
SSDB
Motif
Pfam: 60KD_IMP
Other DBs
NCBI-ProteinID: ABD03183
LinkDB
Position
complement(2346624..2347814)
AA seq 396 aa
MDFGVGFLSNNVMLPILDFFYGIVPSYGLAIIFLTLVIRFALYPLNVGSIRNMRRMKVIS
PVMQRRMRELQEKYRDDPQKLREAQAKLYSELGANPLGGCLPLLIQMPVLFALFATLRGS
PFAAVTYDVNLQILPAEMAAEVVPAPYVSPSKNIFVTDSLHKPVVLVEPKGTKVAVGEEV
QFLLQGPGGKPFEQLVAEAGGDPNLLQPTWKITKGEDRAQIKPDGTLLALQPGDVTVQVS
IPGLASETGFLFIDKLGRVGAFDEDGTIHWDIIAMIVIFGVSIYLNQYLTNAGQDTGKED
PSQSSMARITPVLFSAMFLFFPLPAGVLLYILVSNIFQTVQTFLLSREPLPENLQQLVEE
ERRRAAQAITVEAKEVEKSTKPRAAKEGRESLPFEP
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggacttcggagtcggatttctctccaacaacgtcatgctgccgatcctggattttttc
tatgggatcgtgcccagctatggactggccattatcttcctgacgttggtgatccgcttt
gccctctacccgctcaatgtgggatccatccgcaacatgcggcgcatgaaggtgatcagc
ccggtgatgcagcggcggatgcgagaactccaggagaaataccgagacgacccgcagaag
cttcgggaagcccaggccaagctttacagcgagctgggggccaatcccttggggggctgc
ctgccactgctcattcaaatgccagtgctgtttgccctgtttgccaccctgcggggctcc
ccctttgcagcggtgacctacgatgtcaacttgcagatcctgccggcggaaatggcggct
gaggtggtgcccgccccctacgtcagccccagcaagaacatttttgtcaccgactctctc
cacaagccggtggtgctggtggaacccaaaggcaccaaggttgccgttggggaggaggtg
caatttctgcttcaagggccggggggcaagccttttgagcagttggtggccgaagcgggt
ggggatcccaatctgttacagcccacctggaagatcaccaaaggagaagatcgtgcccag
ataaagccggatggcaccttgctggctctgcagccgggggatgtgaccgtgcaggtgtct
attcccggtttggcctctgagactggctttctgttcatcgacaagttgggccgtgtggga
gccttcgacgaggatggcaccatccactgggatatcatcgccatgatcgtcatctttggg
gtgtccatttacctgaaccagtacctaaccaatgccggacaggataccggcaaagaggat
cccagccaaagttccatggctcgcatcacccctgtgctgttctcggcgatgttcctgttc
ttccctctgccggcaggggttttgctctacatccttgtctctaatatcttccaaacggtg
cagactttcctgctctcgcgggagccgttgccggagaacttacagcagttggtggaagag
gagcgtcgtcgggctgcccaggcgatcacggtggaggccaaggaagtggaaaaatcgacc
aagcccagagcagccaaggagggacgggaatccttgccctttgagccctag

DBGET integrated database retrieval system