Gloeothece citriformis: PCC7424_4067 Help Entry PCC7424_4067      CDS       T00808                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cyc  Gloeothece citriformis Pathway cyc01100   Metabolic pathways cyc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cyc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PCC7424_4067    00074 Mycolic acid biosynthesis     PCC7424_4067   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PCC7424_4067 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ACK72440 UniProt:  B7KL68 LinkDB All DBs Position complement(4510091..4510339) Genome browser AA seq 82 aa AA seqDB search MNQEIFERVKKVVIDQLEVPEDSVVPEASFANDLNADSLDTVELVMALEEEFDIEIPDEE AEKIDTVGKAVEHISEKVEATA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaatcaagaaatttttgaaagagtcaaaaaagttgtcattgaccaactagaagtccca gaagatagtgtcgtccctgaagccagttttgctaatgatttaaatgcagactccttggac acagtagaattagtcatggctttagaagaagaatttgatatcgaaattcctgacgaagaa gccgagaaaatcgatactgtaggcaaagcagtagaacatatcagcgaaaaagtagaagca acagcttaa

DBGET integrated database retrieval system