Rippkaea orientalis PCC 8802: Cyan8802_2874 Help Entry Cyan8802_2874     CDS       T00968                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cyh  Rippkaea orientalis PCC 8802 Pathway cyh01100   Metabolic pathways cyh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cyh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Cyan8802_2874    00074 Mycolic acid biosynthesis     Cyan8802_2874   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Cyan8802_2874 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ACV01724 LinkDB All DBs Position complement(2911507..2911743) Genome browser AA seq 78 aa AA seqDB search MSTLSKVQEIVAEQLGVEKDKVQPEAKFAEDLGADSLDTVELVMALEEAFDIEIPDEEAE KLETVQAAIDYIEKLENQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcaaccttgagcaaagttcaggaaatcgtagccgagcaactcggagtcgaaaaagac aaagttcaaccagaagccaaatttgccgaagatttaggggcagactccctagacacggtg gaactggttatggctttagaagaagcatttgatattgaaattcctgatgaggaagccgaa aaactcgagacagtacaggctgccatcgattatatcgagaaactagagaaccagtag

DBGET integrated database retrieval system