Cyanothece sp. PCC 7425: Cyan7425_2228 Help Entry Cyan7425_2228     CDS       T00836                                  Name (GenBank) cytochrome b559, alpha subunit   KO K02707   photosystem II cytochrome b559 subunit alpha Organism cyn  Cyanothece sp. PCC 7425 Pathway cyn00195   Photosynthesis cyn01100   Metabolic pathways Module cyn_M00161   Photosystem II cyn_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:cyn00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     Cyan7425_2228  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:cyn00194]     Cyan7425_2228 Photosynthesis proteins [BR:cyn00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     Cyan7425_2228 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559a Cytochrom_B559 Motif Other DBs NCBI-ProteinID:  ACL44589 UniProt:  B8HVD7 LinkDB All DBs Position 2145167..2145421 Genome browser AA seq 84 aa AA seqDB search MAGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPNEYYSQVR QELPIISDRLEGKQQINEFLKEVK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt gtggccggtacaacgggtgagcgtcctttttccgatattattaccagtgtgcgttactgg gtgatccacagtattacgatccccgctttgttcattgctggttggttgtttgtcagcact ggccttgcctatgatgtgtttggcacccccagaccaaatgaatactatagccaggtacgg caggaattaccgatcatttctgaccgtctggaaggcaaacagcaaatcaacgaattcctg aaagaagttaaatag

DBGET integrated database retrieval system