Cyanothece sp. PCC 7425: Cyan7425_3162 Help Entry Cyan7425_3162     CDS       T00836                                  Name (GenBank) conserved hypothetical protein   KO K05583   NAD(P)H-quinone oxidoreductase subunit L [EC:7.1.1.2] Organism cyn  Cyanothece sp. PCC 7425 Pathway cyn00190   Oxidative phosphorylation cyn01100   Metabolic pathways Module cyn_M00145   NAD(P)H:quinone oxidoreductase, chloroplasts and cyanobacteria Brite KEGG Orthology (KO) [BR:cyn00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Cyan7425_3162 Enzymes [BR:cyn01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      Cyan7425_3162 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NdhL Motif Other DBs NCBI-ProteinID:  ACL45490 UniProt:  B8HN21 LinkDB All DBs Position 3136202..3136429 Genome browser AA seq 75 aa AA seqDB search MNLPTMTIGLLYLALAGAYLIVFPLITYLYLQTRWYVASSFERGFMYFLMFFFFPGMLLF APFLNFRPQRRQIEA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgaatctacccactatgaccatcgggctgctctacctggctctagccggtgcctatctg atcgtttttccactcatcacctatctctacttacagacccgctggtacgttgccagttct tttgagcgcgggtttatgtacttcctgatgttcttctttttccctggcatgctactgttt gccccatttctcaactttcgtccccaacggcggcaaattgaagcctga

DBGET integrated database retrieval system