Rippkaea orientalis PCC 8801: PCC8801_3247 Help Entry PCC8801_3247      CDS       T00806                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cyp  Rippkaea orientalis PCC 8801 Pathway cyp01100   Metabolic pathways cyp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cyp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PCC8801_3247    00074 Mycolic acid biosynthesis     PCC8801_3247   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PCC8801_3247 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Inhibitor_I24 HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ACK67220 UniProt:  B7JYB8 LinkDB All DBs Position 3384439..3384675 Genome browser AA seq 78 aa AA seqDB search MSTLSKVQEIVAEQLGVEKDKVQPEAKFAEDLGADSLDTVELVMALEEAFDIEIPDEEAE KLETVQAAIDYIEKLENQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcaaccttgagcaaagttcaggaaatcgtagccgagcaactcggagtcgaaaaagac aaagttcaaccagaagccaaatttgccgaagatttaggggcagactccctagacacggtg gaactggttatggctttagaagaagcatttgatattgaaattcctgatgaggaagccgaa aaactcgagacagtacaggctgccatcgattatatcgagaaactagagaaccagtag

DBGET integrated database retrieval system