KEGG   Cycloclasticus sp. P1: Q91_2153
Entry
Q91_2153          CDS       T02265                                 
Symbol
tonB
Name
(GenBank) TonB-like protein
  KO
K03832  periplasmic protein TonB
Organism
cyq  Cycloclasticus sp. P1
Brite
KEGG Orthology (KO) [BR:cyq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyq02000]
    Q91_2153 (tonB)
Transporters [BR:cyq02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Q91_2153 (tonB)
SSDB
Motif
Pfam: TonB_C TonB_2 Questin_oxidase Cob_adeno_trans HSP70
Other DBs
NCBI-ProteinID: AFT68186
LinkDB
Position
complement(2255813..2256664)
AA seq 283 aa
MAAPAAISSADKLGLTLFMAGIIHALVILGISFDVDISRSVSQALEVVLVVSPDKERPEK
ADFLAQEDQVGSGEAEEKAVNQQQAALQPKKQSAQSEHTKEQQALAQAQKALLQTEADVA
IEASNKKVPKQSKALTTADLLRQSEEIAKLQAEINEAVTSYSRRPRKLHINSINAHKYKA
ASYEAAWQRKIERVGNLNYPGEVRRKRLSGTLVMSVELYADGNLKKIIINRRSGHKIIDD
AAVNIVKLSAPFAPLPIDLQKDIDILVITRTWQFLNEGSLLTR
NT seq 852 nt   +upstreamnt  +downstreamnt
gtggctgctccagctgccatatcatcagcggataagctgggtttaacgttatttatggcg
ggcattattcatgccttggttattttgggtattagttttgatgtcgatatctcgcgttcc
gttagtcaggcactagaggttgtgttggtggtatcgccggataaagagcggcctgaaaaa
gctgattttttagcccaagaagatcaagttggtagtggcgaagcggaagaaaaggcagtt
aatcaacagcaagcagcgttgcagccgaaaaagcagtcagcacaatctgagcatacgaaa
gagcagcaagcgctggcccaggctcaaaaggcgctcttgcaaactgaagcggatgtggca
attgaggctagcaataaaaaagtgccaaagcaaagcaaggcattaacgacggctgattta
ttgcgtcaaagtgaggaaattgcaaaacttcaggcagaaattaatgaagcggttaccagt
tattcacgacggcctcgaaaattacacatcaactcaattaatgcgcataaatacaaagcg
gccagttacgaagcggcttggcaacgcaaaattgagcgagtgggcaatttgaattatcca
ggggaagtgaggcgtaagcgtttgtcgggcacattagtaatgagcgttgaattatatgcc
gatggtaatttaaagaaaatcataattaatcgccgctctggtcataaaattattgatgat
gcagcagtcaatattgttaaactatcggcaccatttgccccgctccctattgatctgcaa
aaagatattgatattttggtcatcacgaggacctggcaatttttaaatgaaggctctttg
ctaacacgctaa

DBGET integrated database retrieval system