Clavibacter zhangzhiyongii: H9X71_07835 Help Entry H9X71_07835       CDS       T07408                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism czh  Clavibacter zhangzhiyongii Pathway czh01100   Metabolic pathways czh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:czh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H9X71_07835    00074 Mycolic acid biosynthesis     H9X71_07835   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H9X71_07835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QOD42564 UniProt:  A0A7L7YYP3 LinkDB All DBs Position complement(1649583..1649831) Genome browser AA seq 82 aa AA seqDB search MALSTEEVLAGLAELVNDETGIATDTVEMDKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DEEVKNLKTVGDAVTFITNAQS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcactgtccaccgaagaagtcctggccggcctggccgagctcgtcaacgacgagacc gggatcgccaccgacaccgtcgagatggacaagtcgttcaccgacgacctggacatcgac tcgatctcgatgatgacgatcgtcgtcaacgccgaggagaagttcgacgtgaagatcccg gacgaggaagtcaagaacctcaagaccgtcggcgacgcggtcacgttcatcaccaacgcg cagtcctga

DBGET integrated database retrieval system