Clavibacter zhangzhiyongii: H9X71_14575 Help Entry H9X71_14575       CDS       T07408                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism czh  Clavibacter zhangzhiyongii Brite KEGG Orthology (KO) [BR:czh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:czh03032]     H9X71_14575    03036 Chromosome and associated proteins [BR:czh03036]     H9X71_14575    03400 DNA repair and recombination proteins [BR:czh03400]     H9X71_14575 DNA replication proteins [BR:czh03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     H9X71_14575 Chromosome and associated proteins [BR:czh03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     H9X71_14575 DNA repair and recombination proteins [BR:czh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       H9X71_14575 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  QOD43765 UniProt:  A0A7L7Z275 LinkDB All DBs Position complement(3055812..3056099) Genome browser AA seq 95 aa AA seqDB search MADKSLNRTELVAAVAAESGQSQAAVNGVLDALFSTVATNVADGVKVTIPGWVAFEQTAR AARTGRNPQTGEPLEIKASKGVKVSAGSKLKAAVK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctgacaagtcactcaaccgcaccgagctcgttgccgccgtcgccgcggagtcggga cagagccaggccgccgtcaacggcgtcctcgacgctctcttctccaccgtcgcgaccaac gtcgccgacggcgtcaaggtcacgatcccgggctgggtcgcgttcgagcagacggctcgc gccgcgcgcacgggccgcaacccgcagacgggcgagcccctcgagatcaaggcgtccaag ggcgtcaaggtctccgccggcagcaagctcaaggccgccgtcaagtag

DBGET integrated database retrieval system