Delftia acidovorans: Daci_1463 Help Entry Daci_1463         CDS       T00620                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism dac  Delftia acidovorans Brite KEGG Orthology (KO) [BR:dac00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dac03036]     Daci_1463 Chromosome and associated proteins [BR:dac03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Daci_1463 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  ABX34107 UniProt:  A9BUJ9 LinkDB All DBs Position 1637510..1637794 Genome browser AA seq 94 aa AA seqDB search MLRLNLVLLLAVMASAIFLVHNQYESRRLFTELDRAVAESRRLATEQQRLQVEKRAQATP QRIEVMARERLQMKPATPAIAQYVNDDARTGVAP NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgctgcgcctgaacctcgtgctgctgctggcggtgatggccagcgccatcttcctggtg cacaaccagtacgaatcgcgccgcctgttcaccgaactggaccgcgccgtggccgagtcg cgccgcctggccaccgagcagcagcgcctgcaggtggaaaagcgcgcccaggccacgccg cagcgcatcgaggtcatggcgcgcgagcgcctgcagatgaagccggccacgccggccatc gcccagtacgtcaatgacgatgcgcgcaccggagtggctccatga

DBGET integrated database retrieval system