Delftia acidovorans: Daci_1815 Help Entry Daci_1815         CDS       T00620                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism dac  Delftia acidovorans Brite KEGG Orthology (KO) [BR:dac00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:dac03110]     Daci_1815 Chaperones and folding catalysts [BR:dac03110]  Protein folding catalysts   Protein disulfide isomerase    Daci_1815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  ABX34457 UniProt:  A9BUZ5 LinkDB All DBs Position 2011869..2012126 Genome browser AA seq 85 aa AA seqDB search MQAVKMYTTAVCPYCIRAKQILKSKGVEQIEEIRIDTDPAARDVMMQSTGRRTVPQIFIG DYHVGGCDDLMALDADGGLVPLLQS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagccgtgaagatgtacaccaccgctgtctgcccctattgcatccgggccaagcag atcctcaagtccaagggcgtggagcagatcgaagagatccgcatcgacaccgatccggcc gcgcgcgacgtgatgatgcagagcacgggccgccgcacggtgccccagatcttcatcggc gattaccatgtgggcggctgcgacgacctgatggcgctggacgccgacggcggtctggtg cctctgctgcaaagctga

DBGET integrated database retrieval system