Delftia acidovorans: Daci_2399 Help Entry Daci_2399         CDS       T00620                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism dac  Delftia acidovorans Pathway dac00190   Oxidative phosphorylation dac01100   Metabolic pathways dac02020   Two-component system Module dac_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:dac00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Daci_2399  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Daci_2399 Enzymes [BR:dac01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Daci_2399 SSDB OrthologParalogGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ABX35037 UniProt:  A9BVH0 LinkDB All DBs Position 2649727..2649852 Genome browser AA seq 41 aa AA seqDB search MWYFAWLLGLPLAAAFAVLNAMWYELMDDEATRRELLAREK NT seq 126 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcgcctggttgctcggcctgccgctggcggccgccttcgcggtgctcaac gcgatgtggtacgaactgatggacgacgaggccacgcgccgcgaactcctggcccgggag aaataa

DBGET integrated database retrieval system