KEGG   Delftia acidovorans: Daci_2676
Entry
Daci_2676         CDS       T00620                                 
Name
(GenBank) phosphonate ABC transporter, ATPase subunit
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
dac  Delftia acidovorans
Pathway
dac02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:dac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Daci_2676
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_2676
Enzymes [BR:dac01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     Daci_2676
Transporters [BR:dac02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    Daci_2676
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_16 RsgA_GTPase SMC_N AAA_13 NACHT nSTAND1 AAA_22 AAA_30 FtsK_SpoIIIE AAA_28 AAA_27
Other DBs
NCBI-ProteinID: ABX35314
UniProt: A9BTQ0
LinkDB
Position
complement(2945745..2946584)
AA seq 279 aa
MKLEKDRDVLSLKGVSVRYVDSTVALHPTSLDVKQGEFLVLLGASGAGKSTLLRSINGLV
LPTKGEVSIPGLAGGVVNAKTLREHRKRCGMVFQQHHLIGRQSVLRNVLMGKLGDRGAFA
SLWPWSKKDKLEALTVIERVGLLEKALSRADALSGGQQQRVGIARALIQKPRILLADEPV
ASLDPATAHSVLTLLHEICKKDHLTAIVSLHQVELARSFADRIIGLRQGAVVFEGRAEQL
SPDVARNLYAKQSNASNTSASTDSPRTLQSSQTKELLPC
NT seq 840 nt   +upstreamnt  +downstreamnt
atgaagttggagaaggaccgagacgttctgagtctcaagggagtttccgtccgctacgtt
gactcgaccgtggccttgcacccgacgagtctggatgtgaagcagggagagtttttggtg
cttctgggcgcctcgggcgcagggaagtccaccttgttacgaagcatcaatggactggtg
ctgcccacaaaaggcgaggtatcgatacctggcctggcaggtggggtagtcaacgcaaag
acgctgagagagcaccgcaagcgctgtgggatggttttccagcagcatcatctgattgga
cgtcagtcggtcctcaggaatgttctgatgggaaagctcggtgacaggggtgcattcgct
tcgctatggccgtggagcaagaaggacaagctggaggcgctcacagtgattgagcgtgtc
gggctgctcgaaaaggcgctctcccgggctgatgccttgtctggggggcagcagcagcgc
gtaggcatagctagggcgctaatacagaagccacgaatcctgctggccgatgagcctgtt
gccagcctggacccggcaaccgcacatagcgtgctcaccttgttgcatgagatctgcaaa
aaggaccacctcaccgcaatcgtgagtcttcaccaggtggagctcgcgcgctcgtttgca
gaccgaatcattgggctccgccagggagctgttgtattcgagggtagggcagagcagctg
agtcctgatgttgcgcggaacctctatgcaaagcagtccaacgcttccaacacgagtgcg
tccactgatagcccccgaactcttcaatccagtcaaaccaaggagctcttgccatgctga

DBGET integrated database retrieval system