KEGG   Dactylosporangium sp. AC04546: KZZ52_14325
Entry
KZZ52_14325       CDS       T10220                                 
Name
(GenBank) M56 family metallopeptidase
  KO
K02172  bla regulator protein blaR1
Organism
dact  Dactylosporangium sp. AC04546
Pathway
dact01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:dact00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    KZZ52_14325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dact01002]
    KZZ52_14325
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:dact01504]
    KZZ52_14325
Peptidases and inhibitors [BR:dact01002]
 Metallo peptidases
  Family M56
   KZZ52_14325
Antimicrobial resistance genes [BR:dact01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    KZZ52_14325
SSDB
Motif
Pfam: Peptidase_M48
Other DBs
NCBI-ProteinID: WVK86495
LinkDB
Position
3093805..3094734
AA seq 309 aa
MTAVLVTVFAGLLLAGGPRLARARWVVRAPGLALLVWQMTCAAVVMSVSVAGLTSVLHWD
DTHNLMCSAWRLCLDALYGDHGRVAQAGAVAGAAVLAVTAGRLLHAAWRVQRADRAHGRR
MREVIRSVGSREPGLGATVLPSPEAAAYLVPGGHRDVVVTSGALRRLSPDELRAVMAHEH
AHASGRHYRLLRTARMLHRAFPRVPLFRLAEDQVHRLVELHADDVAVRSAAPLSLARALV
TMAESRAAQAPGGPLLAAAGGDAAERLERLLCPPAPLPSPAARVAAVVAALLPLVPILLA
LAGRQVTLL
NT seq 930 nt   +upstreamnt  +downstreamnt
gtgaccgcggtcctcgtcacggtgttcgcgggattgctgctggccggcgggccgcgcctg
gcccgggcgcggtgggtcgtgcgggcgcccggcctcgccctgctcgtctggcagatgacg
tgcgcggcggtcgtcatgtcggtcagcgtggccgggctgacctccgtactgcattgggac
gacacgcataacctgatgtgctcggcctggcggctctgtctcgacgcgctctacggcgac
cacggccgtgtcgcgcaggccggggccgtcgcaggagcggccgttctggcagtgacggcc
gggcgcctgctgcacgccgcctggcgggtgcaacgggccgaccgggcgcacgggcgccgg
atgcgggaagtgatccgttccgtcggttcgcgtgagcccggcctcggcgccaccgtactg
ccctcgcctgaggccgcggcctacctcgtgccgggcgggcaccgcgacgtggtggtcacc
tccggcgcgttgcggcggctcagccccgacgagctgcgtgcggtgatggcgcacgagcac
gctcacgcctccggtcggcactaccggctgctgcggaccgcccgcatgctgcatcgggcc
tttccccgggtaccgctgttccgcctggccgaggaccaggtccaccggctcgtcgagctg
cacgccgacgacgtggccgtccggtcggcggcgccgctgagcctggcccgggcgctggtc
acgatggccgaatcgcgagccgcgcaggcgcccggcggccccttgctggcagccgctggc
ggcgacgccgcggaacggctcgaacggctcttgtgcccgcccgcgccgctgccgagcccg
gccgcgcgcgtcgcggccgtcgtcgcggcactgctgccgctggtgccgattttgctggcg
ctcgccggccggcaggtcacgctcctctga

DBGET integrated database retrieval system