Danio aesculapii (panther danio): 130222619 Help Entry 130222619         CDS       T11734                                  Symbol dynlt1b Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism daes  Danio aesculapii (panther danio) Pathway daes04145   Phagocytosis daes04814   Motor proteins daes05132   Salmonella infection Brite KEGG Orthology (KO) [BR:daes00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     130222619 (dynlt1b)   09142 Cell motility    04814 Motor proteins     130222619 (dynlt1b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130222619 (dynlt1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:daes03037]     130222619 (dynlt1b)    04812 Cytoskeleton proteins [BR:daes04812]     130222619 (dynlt1b) Cilium and associated proteins [BR:daes03037]  Motile cilia and associated proteins   Dynein arm    130222619 (dynlt1b) Cytoskeleton proteins [BR:daes04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      130222619 (dynlt1b) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  130222619 NCBI-ProteinID:  XP_056311132 LinkDB All DBs Position 4:59661047..59665471 Genome browser AA seq 113 aa AA seqDB search MDDDQIVEESAFIVDEVSSIVKESLEAVIGRNTYEHKRVSQWTSSVAEQCLGQLSKLGKP FKYIVTCIIMQKNGAGLQSASSCFWDNTTDGSCTVRWENKYLYCIVSVFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgacgatcagatagtagaagagagcgcgtttatagtggatgaagtgagcagcatc gtgaaagagtctctagaagcggtgattggcagaaacacgtatgaacacaagcgtgtgagc caatggacgtccagcgtggcggagcagtgtctcgggcagctcagcaaactgggcaaaccc ttcaaatacatcgtcacgtgcatcatcatgcagaagaacggcgctggccttcagtcggcc tcctcctgcttctgggacaacaccacagatggaagctgcacagtcagatgggagaataaa tacctctactgcatcgtcagtgttttcggactcgccatctag

DBGET integrated database retrieval system