Danio aesculapii (panther danio): 130237065 Help Entry 130237065         CDS       T11734                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism daes  Danio aesculapii (panther danio) Pathway daes04137   Mitophagy - animal daes04140   Autophagy - animal daes04142   Lysosome biogenesis daes04144   Endocytosis daes04145   Phagosome daes04148   Efferocytosis daes05132   Salmonella infection Brite KEGG Orthology (KO) [BR:daes00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130237065 (rab7a)    04145 Phagosome     130237065 (rab7a)    04142 Lysosome biogenesis     130237065 (rab7a)    04140 Autophagy - animal     130237065 (rab7a)    04137 Mitophagy - animal     130237065 (rab7a)    04148 Efferocytosis     130237065 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130237065 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:daes04131]     130237065 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:daes04147]     130237065 (rab7a)    04031 GTP-binding proteins [BR:daes04031]     130237065 (rab7a) Membrane trafficking [BR:daes04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     130237065 (rab7a) Exosome [BR:daes04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130237065 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    130237065 (rab7a)   Exosomal proteins of colorectal cancer cells    130237065 (rab7a)   Exosomal proteins of bladder cancer cells    130237065 (rab7a) GTP-binding proteins [BR:daes04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     130237065 (rab7a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 NTPase_1 AAA_7 AAA_22 G-alpha AAA_5 AAA_24 NB-ARC ATPase_2 AAA_14 NACHT SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  130237065 NCBI-ProteinID:  XP_056323843 LinkDB All DBs Position 11:19960763..19986023 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagttcttctgaaggtgatcattcttggagattccggggttgga aaaacgtctctaatgaaccagtatgtgaataaaaagttcagtaatcagtataaagcaact ataggagcagatttcctgacaaaagaagtgatggttgacgaccggcttgtcacaatgcag atatgggacacagcaggtcaggagcggtttcagtctctgggtgttgctttctaccgtggt gctgactgctgtgtgctggtgtttgatgtcactgccccgaacaccttcaagacactggac agctggagagatgagtttctgatccaggccagtcctcgagatccagagaactttcccttc gtggtgctgggcaacaaaatcgatctggagaatagacaggtaacaaccaagcgggcacag gcgtggtgtcagagtaagaacaacatcccgtattttgagaccagtgcaaaggaggccatc aacgtagagcaggcattccagaccatcgcacgcaatgcactcaaacaggaaactgaagtg gagttatacaacgagttccctgagccaattaaactagaccggaacgatagagccaaacca tcagcagagacctgtagctgctga

DBGET integrated database retrieval system