Deinococcus aetherius: DAETH_19260
Help
Entry
DAETH_19260 CDS
T08646
Name
(GenBank) delta-aminolevulinic acid dehydratase
KO
K01698
porphobilinogen synthase [EC:
4.2.1.24
]
Organism
dah
Deinococcus aetherius
Pathway
dah00860
Porphyrin metabolism
dah01100
Metabolic pathways
dah01110
Biosynthesis of secondary metabolites
dah01120
Microbial metabolism in diverse environments
dah01240
Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:
dah00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00860 Porphyrin metabolism
DAETH_19260
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
dah04147
]
DAETH_19260
Enzymes [BR:
dah01000
]
4. Lyases
4.2 Carbon-oxygen lyases
4.2.1 Hydro-lyases
4.2.1.24 porphobilinogen synthase
DAETH_19260
Exosome [BR:
dah04147
]
Exosomal proteins
Exosomal proteins of other body fluids (saliva and urine)
DAETH_19260
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ALAD
PIG-L
Motif
Other DBs
NCBI-ProteinID:
BDP41957
UniProt:
A0ABN6RF18
LinkDB
All DBs
Position
complement(1915817..1916806)
Genome browser
AA seq
329 aa
AA seq
DB search
MLDRPRRLRRTAGLRAMTREVTLSPQHFIHPIFVHEGETEEPIATMPGVSRHSVEGAVEQ
ARAARDLGIPSVILFGIPDHKDPEGSQAYAEGGVIQRAATAIKAALPDVTVIADTCLCEY
TDHGHCGPLCQTGDGEWTVDNDAALDLLARTAVSQARAGADIVAPSAMMDGQVGAIRSAL
DKAGFSHVPVMAYAVKYASAYYGPFRDAAGSTPSVGNRASYQMDPAGGEREALREARLDA
EQGADFLMVKPALAYLDMVRLLRDTFDLPLVAYNVSGEYALVKAAVQAGYMDERRTVLET
LTGMRRAGADAIITYHALDAARWLREGSR
NT seq
990 nt
NT seq
+upstream
nt +downstream
nt
atgttggaccgtccccgccgtctgcgccgcactgctggcctgcgggccatgacccgtgag
gtcacgctttctccgcagcatttcatccaccccatcttcgtccacgagggggagaccgag
gagcccatcgccaccatgccgggcgtgagccgccacagcgtcgagggcgccgtcgagcag
gcgagagccgcccgcgacctcggcatccccagcgtgatcctcttcggcatccccgaccac
aaggaccccgaaggcagccaggcctacgcggagggcggcgtgattcagcgcgcagcgacc
gccatcaaggccgccctgcccgacgtgaccgtcatcgccgatacctgcctgtgcgagtac
accgaccacggccactgcgggccgctgtgccagacgggggacggcgagtggacggtggac
aatgacgcggccctcgatctccttgccaggaccgccgtgtcccaggcgcgggcgggcgcg
gacatcgtggcccccagcgcgatgatggacggccaggtcggcgcgattcgctcggccctg
gacaaggcgggcttctcacacgtccccgtcatggcctacgcggtcaagtacgcctcggcc
tactacgggcccttccgcgacgcggcgggcagcacccccagcgtcggcaaccgagcgtcg
taccagatggacccggcgggcggcgagcgcgaggcgctgcgggaggccaggctcgatgcc
gagcagggtgcggatttcctgatggtcaagcccgcgctggcgtacctcgacatggtgagg
ctgctgcgcgacaccttcgacctgcccctcgtcgcctacaacgtgagcggcgagtacgcg
ctcgtcaaggccgccgtgcaggccgggtacatggacgagcgccgcaccgtgctggagacg
ctgaccgggatgcgccgtgccggggccgacgcgattatcacctaccacgctctcgacgcc
gcccgctggctccgggaggggtcaaggtga
DBGET
integrated database retrieval system