Dechloromonas aquae: VX159_00270
Help
Entry
VX159_00270 CDS
T10882
Name
(GenBank) F0F1 ATP synthase subunit epsilon
KO
K02114
F-type H+-transporting ATPase subunit epsilon
Organism
daj Dechloromonas aquae
Pathway
daj00190
Oxidative phosphorylation
daj01100
Metabolic pathways
Module
daj_M00157
F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:
daj00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
VX159_00270
09180 Brite Hierarchies
09181 Protein families: metabolism
00194 Photosynthesis proteins [BR:
daj00194
]
VX159_00270
Photosynthesis proteins [BR:
daj00194
]
Photosystem and electron transport system
F-type ATPase [OT]
VX159_00270
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ATP-synt_DE_N
ATP-synt_DE
DUF6519
Motif
Other DBs
NCBI-ProteinID:
WVT84285
LinkDB
All DBs
Position
55693..56118
Genome browser
AA seq
141 aa
AA seq
DB search
MVMTVHCDVVSAEESIFSGLVEIAVFPGEAGELGILPKHTPLLTRIKPGTIRLKVPAQDE
FELVYVSGGMLEVQPDMVTVLADTAIRAHDLDEAKAMEAKKRAEEALANRQAEMDYAAAE
AELAQAIAQLQTIQRLRKHTH
NT seq
426 nt
NT seq
+upstream
nt +downstream
nt
atggtaatgactgttcattgtgatgtcgtcagcgccgaagagtcgatcttctccggcctc
gtcgaaatcgcggtgttccccggcgaagccggggagcttggcatcctgccgaagcacacc
ccgcttctgacccgtatcaagcctggtaccattcgtttgaaggtgccggctcaggacgag
ttcgaactggtgtatgtctccggtggcatgctggaagtccagcctgatatggttaccgtt
ttggcggataccgccatccgggcccatgatctggacgaagccaaggccatggaagccaag
aagcgtgccgaagaggctttggcaaaccgccaagccgaaatggattacgctgccgctgaa
gcagaactggcgcaggcaattgcccagttgcagacaattcagcgtttgcgcaagcatact
cactga
DBGET
integrated database retrieval system