Desulfurivibrio alkaliphilus: DaAHT2_1140 Help Entry DaAHT2_1140       CDS       T01244                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dak  Desulfurivibrio alkaliphilus Pathway dak00998   Biosynthesis of various antibiotics dak01100   Metabolic pathways dak01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dak00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DaAHT2_1140    00074 Mycolic acid biosynthesis     DaAHT2_1140   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DaAHT2_1140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L6 Motif Other DBs NCBI-ProteinID:  ADH85838 UniProt:  D6Z2R3 LinkDB All DBs Position complement(1355833..1356111) Genome browser AA seq 92 aa AA seqDB search MESQDRALAEELLPLIVETCRLPARELEVAAIMDQPLIGPDSPLEIDSLDAVEIVVAVQN RYGVRIESVESGQRIMASLTSLAAFIRQHRTL NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggaaagtcaggatcgggcgctggccgaggagctgctgccccttattgttgaaacctgc cggttgccggccagggagttggaggtggcggcaattatggaccagcccttgatcgggccg gactcgccccttgagatcgactccctggatgcggtggagatcgtagtggcggtgcagaat cgctacggggtgcggattgaatccgttgagagcggccagcggatcatggcctcgctaacg tcgttggccgccttcatccgccaacaccgcaccctgtag

DBGET integrated database retrieval system