Desulfatibacillum aliphaticivorans: Dalk_3308 Help Entry Dalk_3308         CDS       T00813                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dal  Desulfatibacillum aliphaticivorans Pathway dal00998   Biosynthesis of various antibiotics dal01100   Metabolic pathways dal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Dalk_3308    00074 Mycolic acid biosynthesis     Dalk_3308   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Dalk_3308 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF5785 Motif Other DBs NCBI-ProteinID:  ACL04997 UniProt:  B8FJ70 LinkDB All DBs Position 4205139..4205369 Genome browser AA seq 76 aa AA seqDB search MSLEEKVKNIIVDKLGVEPDEVVEEASFVDDLGADSLDLVELIMSMEETFDLEISDEEAE KILKVKDVIEYIKAHT NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtctttggaagaaaaagtaaaaaacataatcgtggataaactgggcgtggagcctgat gaagttgtggaagaagcgtcttttgtggatgacctgggcgccgattccctggacctggtt gaactgattatgagcatggaagaaacctttgacctggaaatctccgatgaagaagcggaa aaaatcctcaaggtcaaagacgtcattgaatatatcaaagcgcacacctaa

DBGET integrated database retrieval system