Desulfosarcina alkanivorans: DSCA_30400 Help Entry DSCA_30400        CDS       T06544                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dalk  Desulfosarcina alkanivorans Pathway dalk01100   Metabolic pathways dalk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dalk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSCA_30400 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSCA_30400 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  BBO69110 UniProt:  A0A5K7YLL7 LinkDB All DBs Position 3385036..3385263 Genome browser AA seq 75 aa AA seqDB search MSVEDKVKKIIAEKLSVDIAEVVPEASFVDDLGADSLDLVELIMSMEEEFDVDISDEDAE KLVSVKDAFDYIKEH NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtctgtagaagataaagtcaaaaaaatcatcgccgaaaaactcagtgtggacatcgcc gaagtggttccggaggcctcttttgtcgacgacctgggtgctgacagcctcgacctggta gaactgatcatgtccatggaagaggagttcgacgtcgacatttccgatgaagatgcggaa aaactggtttctgtcaaagacgccttcgactatatcaaggaacactga

DBGET integrated database retrieval system