Diachasma alloeum: 107035451 Help Entry 107035451         CDS       T07663                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism dam  Diachasma alloeum Pathway dam04137   Mitophagy - animal dam04140   Autophagy - animal dam04144   Endocytosis dam04145   Phagosome dam04148   Efferocytosis Brite KEGG Orthology (KO) [BR:dam00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107035451    04145 Phagosome     107035451    04140 Autophagy - animal     107035451    04137 Mitophagy - animal     107035451    04148 Efferocytosis     107035451  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dam04131]     107035451   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dam04147]     107035451    04031 GTP-binding proteins [BR:dam04031]     107035451 Membrane trafficking [BR:dam04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     107035451 Exosome [BR:dam04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107035451   Exosomal proteins of other body fluids (saliva and urine)    107035451   Exosomal proteins of colorectal cancer cells    107035451   Exosomal proteins of bladder cancer cells    107035451 GTP-binding proteins [BR:dam04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     107035451 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 AAA_16 PduV-EutP Septin AAA_22 AAA_7 AAA_24 G-alpha NTPase_1 AAA_5 ATPase_2 NACHT AAA_14 SRPRB NB-ARC ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  107035451 NCBI-ProteinID:  XP_015108335 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVAAPTSFKSLDSWRDEFLIQASPRDPDNFPF VVLGNKVDLENRAVSNKRAQQWCQSKNNIPYFETSAKEAINVEQAFQTIAKNALAQESEV ELYNEFPDQIKLTNDQRTNGKGDSCAC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcctcacgaaagaaagtactgctcaaagtcattatcctgggggattctggggtcggt aaaacatctctcatgaatcagtacgtcaataagaagtttagtaatcagtataaagcaact attggggcggattttctcaccaaggaagtcatggtcgatgataggatagttaccatgcag atttgggacactgcgggacaagagagattccaatcactgggtgttgcgttctacagggga gctgactgttgcgttttagtgtttgatgttgctgcacccacttccttcaagtcactcgac tcatggagagatgaatttctcattcaagcatcgccgagagatccagacaattttccgttc gtcgttttggggaataaagttgatcttgaaaatagagctgtatcgaataagagagcgcaa cagtggtgtcaatcgaaaaacaatattccatacttcgagacgagtgcgaaggaggctatc aacgtggaacaggcgttccagacgatagcgaagaatgctcttgcccaagagagtgaagtg gagctttataacgaattccccgaccagatcaaactcaccaacgatcaaaggaccaatgga aagggtgactcatgtgcttgctag

DBGET integrated database retrieval system