Diachasma alloeum: 107036483 Help Entry 107036483         CDS       T07663                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dam  Diachasma alloeum Pathway dam04013   MAPK signaling pathway - fly dam04145   Phagosome dam04148   Efferocytosis dam04310   Wnt signaling pathway dam04620   Toll-like receptor signaling pathway dam05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dam00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     107036483    04310 Wnt signaling pathway     107036483  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107036483    04148 Efferocytosis     107036483  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107036483  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107036483  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dam04131]     107036483   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dam04147]     107036483    04031 GTP-binding proteins [BR:dam04031]     107036483 Membrane trafficking [BR:dam04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107036483  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     107036483   Macropinocytosis    Ras GTPases     107036483  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     107036483 Exosome [BR:dam04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107036483   Exosomal proteins of other body fluids (saliva and urine)    107036483   Exosomal proteins of colorectal cancer cells    107036483   Exosomal proteins of bladder cancer cells    107036483 GTP-binding proteins [BR:dam04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107036483 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  107036483 NCBI-ProteinID:  XP_015109954 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIEKLKDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQAKPKRKCCLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgataaagtgcgtcgttgttggtgacggagctgtcggtaagacgtgcctgctg atcagttacaccaccaatgccttccccggggagtacatacccactgtcttcgataactac tcggccaatgttatggtcgatggcaaacctattaatctaggattgtgggacacagccgga caggaggactacgacaggctcaggccactgtcctatcctcagaccgatgtctttctcatc tgcttttcactggtgaatccggcgagctttgagaatgtacgggccaagtggtatcccgag gtgcgtcatcactgtccagccacgccgattatactcgtgggcaccaagctcgatctgcgt gaggataaggagaccattgagaaactcaaagacaaaaaacttgcgcctataacctatcca cagggattggcaatggccaaagaaattggagcagtaaagtatctggagtgctcagccctg acgcaaaagggcctgaagacagtgttcgacgaggcgatacgcgcggtattatgtccagta ctacaggcaaaaccaaagcgcaagtgttgcctcctataa

DBGET integrated database retrieval system