KEGG   Diachasma alloeum: 107047843
Entry
107047843         CDS       T07663                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dam  Diachasma alloeum
Pathway
dam00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dam00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    107047843
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dam00199]
    107047843
Enzymes [BR:dam01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     107047843
Cytochrome P450 [BR:dam00199]
 Cytochrome P450, animal type
  CYP306 family
   107047843
SSDB
Motif
Pfam: p450 Stk19
Other DBs
NCBI-GeneID: 107047843
NCBI-ProteinID: XP_015126184
LinkDB
Position
Unknown
AA seq 489 aa
MWYILVPILISLVIFVSLNNRRKFKLPPGPLPLPVLGNLLSIDPVNPHLSLTTLSRSYSG
ICGLRLGSVYTVLLTDPKLVRQAFAKDAFTGRAPLYLTHGIMKGYGIVCAEGDHWREQRK
FVSSTLKTLGMMKHGSRREKLEERMTHYISQLLEKLTGTDPIQGVDPLESLHHCLGNLIN
DLVFGKVYGEDDETWKWLRYLQEDGVKHIGIAGPLNFLPFLRHLPKYKKLMKFLLDGKLK
THEVYKEIIQSHQEGKDSMRNDSFLSAFAEEIERRVSSNEELGSFTDQQFYHLLADLYGA
GVDTTMTTVRWLLLYLAAYPEDQEKIHEEMVESLGEREVTLEDRGRLLYLEACICEAQRI
RSVVPLGIPHGTKEDTKLGGFDIPKGSMVVPFQWAMHMDERYFEDPEVFRPSRFISEEGL
RRHEAFLPFLTGKRMCVGDELARWILFLFTGRIIQKFRISVPEGETVDFVGDCGITLVPK
PHKLVFLER
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgtggtacattctcgttccgatattaatatccctagtgatcttcgtcagcctgaataat
cggagaaaattcaaacttccgccgggaccacttccgcttccggtcctaggtaatctacta
tcgatagatccggtgaatcctcacctgagtttgacaaccctctcccgaagctactctgga
atatgcggcttgcggctgggctccgtctacacagttttactgacggaccccaaactggtc
agacaggccttcgccaaggacgcctttaccggaagagcgccactctacctgacccacggt
ataatgaagggctacggcatcgtctgcgcggaaggtgatcactggagagaacaaagaaaa
ttcgtgtcatcaaccctgaaaaccctgggtatgatgaaacacgggagtagaagagagaaa
ctcgaggagagaatgacccattacatctctcaactcctcgagaaactgacgggaacagac
ccgatacagggggttgatcccctggagagtctccaccattgcttggggaacctgatcaac
gacctggtgttcgggaaagtttacggggaagacgatgagacctggaagtggctgaggtac
ctgcaggaggacggggtgaagcacattgggatagctggacccctgaatttccttcccttc
cttcgacaccttcctaaatacaagaagctgatgaagttcttgctggatgggaagttgaaa
acacacgaagtttacaaggaaatcatccagagtcatcaggaaggaaaggacagcatgagg
aacgacagctttctctcagcttttgctgaggagatagagaggagagtttcgagtaacgaa
gaattgggttcattcactgatcaacagttttatcatctactcgctgacctttacggggct
ggggtggacacgacgatgacaacagtcaggtggttgttgttgtatctggcggcttacccc
gaggaccaggagaagatccatgaggagatggtggagagtctaggggagagagaggtcact
ctggaggacagggggagattgctgtacctggaagcctgtatctgtgaggctcagaggatc
aggagtgttgtacctctgggaattcctcatgggacgaaggaggacaccaaactcgggggt
tttgatattccaaaggggagcatggtggtgccctttcaatgggcgatgcacatggatgag
aggtactttgaagatcctgaggtgttcaggcccagcaggttcatctcggaggagggattg
aggaggcatgaggcctttcttccttttttaacggggaaacgaatgtgcgttggggacgaa
ctcgccaggtggattctcttcctgttcactgggagaattattcagaagttcagaatttcg
gtacctgagggggagacggtggattttgttggggattgtggcatcacgctggtgccgaaa
ccacacaaactggtgtttttagaacgttaa

DBGET integrated database retrieval system