Drosophila ananassae: 6495681 Help Entry 6495681           CDS       T01059                                  Name (RefSeq) calmodulin isoform X2   KO K02183   calmodulin Organism dan  Drosophila ananassae Pathway dan04070   Phosphatidylinositol signaling system dan04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:dan00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     6495681  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     6495681  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dan01009]     6495681   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dan04131]     6495681    03036 Chromosome and associated proteins [BR:dan03036]     6495681   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dan04147]     6495681 Protein phosphatases and associated proteins [BR:dan01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      6495681 Membrane trafficking [BR:dan04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     6495681 Chromosome and associated proteins [BR:dan03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      6495681 Exosome [BR:dan04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    6495681 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 Dockerin_1 EFhand_Ca_insen DUF1103 Caleosin TerB FCaBP_EF-hand DUF5580_M SPEF2_C MotA_activ Fe_hyd_lg_C SurA_N_3 PA_Ig-like Motif Other DBs NCBI-GeneID:  6495681 NCBI-ProteinID:  XP_001959373 UniProt:  B3MC95 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVTMMTSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagctgacagaggaacagatcgccgagttcaaagaggcattctcgctattc gacaaagacggcgatggcaccatcacaacaaaggagttgggaacagttatgcgctccctg ggccagaatcccacagaggccgagctccaggacatgataaacgaggtcgatgccgacggc aatggtacaattgacttcccagaattccttacaatgatggcacgcaaaatgaaggacacc gatagtgaagaggagatccgagaagccttcagagtgttcgataaggacggtaatggcttc atctcagcggccgagttgcgtcacgtgatgacaaatctgggcgagaaactcacagacgag gaggtcgacgagatgatccgtgaggctgatatcgatggtgatggtcaggtcaattacgaa gaattcgtgactatgatgacatcgaagtga

DBGET integrated database retrieval system