Drosophila ananassae: 6497209 Help Entry 6497209           CDS       T01059                                  Name (RefSeq) troponin C isoform X1   KO K02183   calmodulin Organism dan  Drosophila ananassae Pathway dan04070   Phosphatidylinositol signaling system dan04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:dan00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     6497209  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     6497209  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dan01009]     6497209   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dan04131]     6497209    03036 Chromosome and associated proteins [BR:dan03036]     6497209   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dan04147]     6497209 Protein phosphatases and associated proteins [BR:dan01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      6497209 Membrane trafficking [BR:dan04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     6497209 Chromosome and associated proteins [BR:dan03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      6497209 Exosome [BR:dan04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    6497209 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_9 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 AIF-1 EH EF_EFCAB10_C DUF5580_M CFAP251_C SAPC2_N T2SSK Polysacc_deac_2 Motif Other DBs NCBI-GeneID:  6497209 NCBI-ProteinID:  XP_001962553 UniProt:  B3MLM5 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MEDDEKMDIMRKAFQMFDTQKTGFIETLRLKTILNSMGQMFEESELQDLIDENDPEDTGK VNFDGFCNIAAHFLEEEDAEAIQKELKEAFRLYDREGNGYITTSTLKEILAALDDKLSSS DLDGIIAEIDTDGSGTVDFDEFMEMMTGD NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggaggatgacgagaagatggacatcatgcgcaaggcattccaaatgttcgacacacaa aaaacgggcttcatcgagaccctgcgcctcaagaccatcctgaacagcatgggtcagatg ttcgaggagagcgagctgcaggatctgattgacgagaacgatccggaggatactggaaaa gtaaactttgatggcttctgcaacattgccgcccatttcctcgaggaggaggacgccgag gccattcagaaggagctgaaggaggccttccgtctgtacgatcgcgagggcaacggttac atcaccacctccaccctcaaggaaatccttgccgccctggacgacaagctctcctccagc gatctggacggtatcattgctgagatcgatactgatggctccggaacagtggactttgat gaattcatggagatgatgactggcgattag

DBGET integrated database retrieval system