Drosophila ananassae: 6498854 Help Entry 6498854           CDS       T01059                                  Name (RefSeq) ras-like protein 1   KO K07827   GTPase KRas Organism dan  Drosophila ananassae Pathway dan04013   MAPK signaling pathway - fly dan04068   FoxO signaling pathway dan04137   Mitophagy - animal dan04140   Autophagy - animal dan04150   mTOR signaling pathway dan04213   Longevity regulating pathway - multiple species dan04214   Apoptosis - fly dan04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:dan00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     6498854    04068 FoxO signaling pathway     6498854    04150 mTOR signaling pathway     6498854  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     6498854    04137 Mitophagy - animal     6498854   09143 Cell growth and death    04214 Apoptosis - fly     6498854  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     6498854   09149 Aging    04213 Longevity regulating pathway - multiple species     6498854  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dan04131]     6498854   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:dan04031]     6498854 Membrane trafficking [BR:dan04131]  Endocytosis   Macropinocytosis    Ras GTPases     6498854 GTP-binding proteins [BR:dan04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     6498854 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Aldo_ket_red AAA_25 Motif Other DBs NCBI-GeneID:  6498854 NCBI-ProteinID:  XP_001955794 UniProt:  B3M185 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL ASWNVNNEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRKMNKP NRRFKCKML NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatacaaactggttgtggttggtgccggcggtgtgggcaaatcggcactaacc atccagctaatccagaaccatttcgtggacgagtacgaccccaccatcgaggattcatat cgcaagcaagtggttatagatggagagacatgcctgctggatatcctggacactgctggc caagaagagtactcggctatgcgggatcagtacatgcgcaccggtgagggcttcctactc gtattcgccgtgaacagcgccaagtcctttgaggacattggtacctatcgcgagcaaata aagagggttaaggatgctgaggaggtgcccatggtactggtgggcaacaaatgtgatctg gcctcttggaacgtaaacaacgaacaggcaagagaggtggccaaacaatatggcattcca tatattgagacatcagcgaagacgcgcatgggcgtggacgacgcattttacacattggtg cgcgaaatccgcaaggataaggacaacaagggccggaggggccgaaaaatgaacaagccg aatcgtagatttaaatgtaaaatgctctaa

DBGET integrated database retrieval system