Drosophila ananassae: 6499998 Help Entry 6499998           CDS       T01059                                  Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism dan  Drosophila ananassae Brite KEGG Orthology (KO) [BR:dan00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dan03037]     6499998 Cilium and associated proteins [BR:dan03037]  Primary cilia and associated proteins   BBSome    6499998 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  BBIP10 SWIRM-assoc_1 Motif Other DBs NCBI-GeneID:  6499998 NCBI-ProteinID:  XP_001953436 UniProt:  B3M062 LinkDB All DBs Position Unknown AA seq 83 aa AA seqDB search MSAVEAEVLRKVTEKIDLIEPTTGKLFFEHKAELVFCRPHLMPLKTQALERLEEMHRETA RQLQKKRSTISSQKKVSEPAGSQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtccgctgtggaggccgaggtgttaaggaaagtgactgagaaaatcgatctgattgag cccaccaccggaaaattgtttttcgagcacaaagcagagctggtcttctgccggccgcac ctgatgccgctgaagacgcaggcgctggaacgtctcgaggaaatgcatcgcgaaactgcg cgccaactgcaaaaaaaacgcagcaccatcagcagccaaaaaaaagtcagcgagcccgca ggctcgcaatga

DBGET integrated database retrieval system