Drosophila ananassae: 6501022 Help Entry 6501022           CDS       T01059                                  Name (RefSeq) ubiquitin-like protein 4A   KO K23388   ubiquitin-like protein 4 Organism dan  Drosophila ananassae Pathway dan03060   Protein export Brite KEGG Orthology (KO) [BR:dan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     6501022  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dan04131]     6501022    03400 DNA repair and recombination proteins [BR:dan03400]     6501022 Membrane trafficking [BR:dan04131]  Endoplasmic reticulum (ER) - Golgi transport   Retrieval pathways    Golgi to ER traffic proteins (GET)     6501022 DNA repair and recombination proteins [BR:dan03400]  Eukaryotic type   Check point factors    BAG6-UBL4A-GET4 complex     6501022 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Tugs Cox20 Motif Other DBs NCBI-GeneID:  6501022 NCBI-ProteinID:  XP_001954393 UniProt:  B3LYN9 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MQITIKVLKGQDCLLEVLPTSTILEVKQQIEGELQISAANQKLLLMGRPLNNDQTIASYP NIKQGTKLNLVVMKPCLRDSILRGFRKHFPEQQSERLTNEFMADFERKLTEQSLDDLERF ADSIVSRVPT NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgcagatcacaatcaaagtgctcaagggccaggactgcttgcttgaagtcttgccgaca tccacgattttggaggtgaaacaacaaatagaaggggagctccaaatttcggcggcaaat cagaaactcctgcttatggggcgtcctctgaacaatgaccagaccattgcctcctatccg aacatcaagcagggcaccaaactaaacctggttgtgatgaagccctgcctcagagatagc atactccggggattccgtaagcactttccggaacagcagtcggagcgcttgaccaacgag tttatggccgattttgaaaggaaactaactgaacagagcctggatgatctggagagattt gcagatagtatagtcagcagagtgcccacttag

DBGET integrated database retrieval system