Drosophila ananassae: 6501108 Help Entry 6501108           CDS       T01059                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism dan  Drosophila ananassae Pathway dan04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     6501108  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dan04121]     6501108    03400 DNA repair and recombination proteins [BR:dan03400]     6501108 Ubiquitin system [BR:dan04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      6501108    Cul5 complex      6501108 DNA repair and recombination proteins [BR:dan03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      6501108 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_TPR1 Ubiquitin_2 Motif Other DBs NCBI-GeneID:  6501108 NCBI-ProteinID:  XP_001954564 UniProt:  B3M0B9 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDVFLMIRRQKTTIFTDAKENTTVGELKRMIEGIVKVQPVDQRLYNQDNDVMEDESTLQD YGVTVSTAKAQAPAQLGLTFRNELGDFETLDMTPYSAPPDLPEVMKNQEASNGQEQVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatccgacgacagaagacgaccattttcacggacgccaaagag aacacaacagtcggcgagctgaagcgaatgatcgaaggtatagtcaaggtgcagccggta gaccagcggttatacaatcaagacaacgacgtcatggaagatgagagtacgcttcaggat tatggcgtcactgtgtccacagccaaggcgcaggctccggcgcagttgggcttgacattc agaaacgaattgggcgacttcgagacgctggacatgacaccttactctgcacccccagac ttacctgaagtgatgaaaaaccaagaggcctcaaacggacaggaacaagttgcataa

DBGET integrated database retrieval system