KEGG   Drosophila ananassae: 6505200
Entry
6505200           CDS       T01059                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dan  Drosophila ananassae
Pathway
dan00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dan00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    6505200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dan00199]
    6505200
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     6505200
Cytochrome P450 [BR:dan00199]
 Cytochrome P450, animal type
  CYP306 family
   6505200
SSDB
Motif
Pfam: p450 Drc1-Sld2 Nop25
Other DBs
NCBI-GeneID: 6505200
NCBI-ProteinID: XP_032307883
FlyBase: FBgn0099537
LinkDB
Position
Unknown
AA seq 616 aa
MDAEFSSWLATLLVPGLLILVILYLCEHQYDDIIGVAPPGPWGLPFLGYLPFLDAKRPHK
SLQKLAKRYGGIYQLKMGSVRAVILSDVALVRDFFRHIEMTARAPLYLTHGIMGGYGIIC
AQGALWTHARREVIDWLKALGMTRRPGDLRESLERRIARGVDECVQIYEAEADQSPNSEL
DPVGGLFHTLGNIINDLVFGITYKRDDPDWLYLQKLQEEGVKMIGVSGVVNFLPWLRHLP
ENKRNIRFLLEGKAKTHAIYDRIVASCKEKLNEKLARHREEQEVLRQERRRAQMEQGHPR
QQTEDEDDHDDHGGQHVGDIPEEEEQQEEGNEMGLPFPDENDAEDRQEGEEASGEEENEE
EYDDDDDEEDDEDEEYEPYCILEHFLMNKIPISQLYCDDQLRHLLADLFGAGVDTALATL
RWFLLYMAREQSCQRRLHELLLPLSRSPSLEELEPLAYLRACISETQRIRSVVPLGIPHG
CERDFTVGDYRIRGGSMIVSLQWAIHMDPVAFPDPEQFRPERFLDESGAYVAPPQFVPFQ
TGKRMCPGDELARMMLTLFTGRILRRFHLEMAEDCTVDMNGESGITLTPEPYKLRFNKLP
LMYMRELKNPDDSDLD
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggacgcggagttctcctcctggctggccaccctgctggtgcctggcctcctcatcctg
gtgatcctgtacctctgcgagcaccagtacgatgatattattggtgtggcgccaccagga
ccctggggtctgcccttcttgggatatctgccatttttggatgcgaagagaccgcacaag
tccctccagaagctggctaagaggtatgggggcatctaccaattgaaaatgggcagtgtc
cgggcggtgatcctgtcggatgtggcactcgttcgggactttttccgccacatagagatg
accgcccgggctcccctctacctcacccacggtatcatgggcggatatgggattatctgc
gcccagggtgccctctggacccatgcccgacgcgaggtcatcgattggctgaaggccctg
ggcatgacccgtcgtccgggggacttgcgggagagtctcgagaggcgtattgccagggga
gtggacgagtgtgttcaaatctatgaggctgaggcagatcagagtccaaactctgaactg
gatcctgtaggtggacttttccacactctggggaacattatcaacgatctggtgttcgga
ataacctacaagcgggatgatcccgactggctgtacctgcagaagctgcaggaggagggc
gtcaagatgatcggggtgtccggagtggtgaacttcctgccctggctgcggcatctgccg
gaaaacaagcgcaacattcgcttcctactggagggcaaggccaagacgcatgccatctac
gatcggattgtggcctcgtgcaaggagaagctcaacgagaagctggcgaggcacagggag
gagcaggaggtgctgcgccaggaaaggcgtagagctcagatggagcagggacatccgagg
cagcagacagaggatgaggatgaccacgatgaccacggtgggcagcatgtcggagatatt
ccggaggaggaggagcaacaggaggagggcaatgagatggggttgccatttccagacgag
aatgacgcagaagatcggcaggagggagaagaggcttctggtgaggaggaaaacgaggaa
gagtacgatgatgatgatgacgaggaggatgatgaagacgaggaatacgagccgtattgc
atcttggagcatttcctcatgaacaagattcccatatcgcagctctactgcgacgaccag
ctgcgtcatctgctggccgatctcttcggagccggcgtggacaccgccctggcgactctc
cgatggttccttctctacatggcccgggaacagagttgccagcgccgcctccacgagctc
ctgctgcccctgtcacggtcgcccagtctggaggagctcgagcccctggcctaccttcgg
gcctgcatctcggagacgcagcgcatccggagcgtggtgcccctgggcattccgcacggc
tgtgagagggacttcacagttggggattatcgcattcgtggtggctcgatgatcgtctcg
ctgcagtgggccatacacatggatccggtggcctttcccgacccggaacagttccggccc
gagcgcttcctggacgagtccggagcctatgtggctccgccgcaattcgtgcccttccaa
acgggcaagcgaatgtgccccggcgatgagctggcccggatgatgttgaccctcttcacg
gggcgtatcttaaggcgattccatctggagatggctgaggactgtacggtggacatgaat
ggagagagtggcatcaccctgactccggagccctacaagctgcgcttcaacaaactgccc
ctgatgtatatgcgggaattaaagaatccagatgactcggatctggattaa

DBGET integrated database retrieval system