Dickeya aquatica: DAQ1742_03417 Help Entry DAQ1742_03417     CDS       T06021                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism daq  Dickeya aquatica Pathway daq00998   Biosynthesis of various antibiotics daq01100   Metabolic pathways daq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:daq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DAQ1742_03417    00074 Mycolic acid biosynthesis     DAQ1742_03417   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DAQ1742_03417 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  SLM64225 UniProt:  A0A375ADW4 LinkDB All DBs Position complement(3416665..3416934) Genome browser AA seq 89 aa AA seqDB search MDTQKEILTVVLDVINGIKNTGFTPEIVDLEAFLGGELGVDSVEMLESWYEIEKRLNIKV NDGDKRGIYTLGDLVGTIEAHLPEDALKS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggacactcagaaagagattcttacggtggttcttgatgtgattaatggcatcaaaaac acgggctttaccccggaaattgttgatctggaagcattccttggcggcgaactgggggtg gattcggtggagatgcttgagtcctggtacgaaattgaaaagcgactcaacatcaaggtc aacgacggtgacaagcgcggtatttacacccttggcgacctggtcggcaccattgaggcc catttgccggaagacgcgctcaaatcctga

DBGET integrated database retrieval system