KEGG   Deinococcus aquaticus: M8445_06195
Entry
M8445_06195       CDS       T08867                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
daqu  Deinococcus aquaticus
Pathway
daqu00770  Pantothenate and CoA biosynthesis
daqu01100  Metabolic pathways
daqu01240  Biosynthesis of cofactors
Module
daqu_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:daqu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    M8445_06195 (coaD)
Enzymes [BR:daqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     M8445_06195 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: WDA59787
UniProt: A0ABY7V3L7
LinkDB
Position
complement(1264135..1264686)
AA seq 183 aa
MNAVFPGSFDPITSGHMDVLTRAAKIFDHVTLTVMHNARKQGRHLFTLEERMDILREATT
HLPNVRVDTFGGLLVDYMARQEPGSVILRGLRAVSDYEYELQIAHLNRQIGDAETVFIMA
ATRWSFVSSSMVREIASYGGDVSEMVPRASAAALRRKHADVYAEREAEKEEQKQAQQQEQ
PGR
NT seq 552 nt   +upstreamnt  +downstreamnt
atgaacgctgtctttcccgggtcgttcgaccccatcaccagcgggcacatggacgtcctg
acgcgcgccgcgaagatcttcgaccacgtgaccctgacggtcatgcacaacgcccgcaag
cagggccgccacctgttcacgctggaggaacgcatggacattctgcgcgaggcgaccacg
cacctcccgaacgtccgggtggacaccttcgggggcctgctggtggactacatggcccgc
caggagcccggcagcgtgatcctgcgcggcctgcgggcggtcagcgactacgagtacgag
ttgcagatcgcgcacctgaaccgccagatcggggacgccgagacggtgttcatcatggct
gccacccgctggagtttcgtaagcagctccatggtccgcgagatcgccagttacggcggc
gacgtgagcgagatggtcccgcgcgccagtgccgccgcgctgcgccgcaagcacgccgac
gtgtacgccgaacgcgaggccgagaaggaagagcagaagcaggcgcagcagcaggaacag
ccgggccgctga

DBGET integrated database retrieval system