Dechloromonas aromatica: Daro_2373 Help Entry Daro_2373         CDS       T00259                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dar  Dechloromonas aromatica Pathway dar01100   Metabolic pathways dar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Daro_2373    00074 Mycolic acid biosynthesis     Daro_2373   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Daro_2373 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AAZ47109 UniProt:  Q47DH2 LinkDB All DBs Position 2557494..2557763 Genome browser AA seq 89 aa AA seqDB search MTAELRLELKALIIEACDKDCEPASISDDEVLFGPEAPLQLDSLDALQVSMAIKKKYGLR LPDSKETRRILSSVANMAEHLEAWLASRA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgccgaactccgcctcgaactcaaggccctgatcatcgaagcctgcgataaggac tgcgaaccagccagtatttccgacgacgaagtactgttcggcccggaagccccgctgcaa ctcgattcgctcgacgccttgcaggtctcgatggcgatcaagaaaaaatacggcctgcgc ctgccggacagcaaggaaacccgccgcatcctatccagtgtcgccaacatggccgagcac ctcgaagcctggctggccagtcgcgcatga

DBGET integrated database retrieval system