Dechloromonas aromatica: Daro_2433 Help Entry Daro_2433         CDS       T00259                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism dar  Dechloromonas aromatica Pathway dar01100   Metabolic pathways dar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Daro_2433    00074 Mycolic acid biosynthesis     Daro_2433   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Daro_2433 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AAZ47168 UniProt:  Q47DB3 LinkDB All DBs Position complement(2629584..2629856) Genome browser AA seq 90 aa AA seqDB search MEKMERSLNTEKEVLSLLDEILGLKGRSAEFTSDTPLLGAIPELDSMAVVALITALEERF GFAIEDDEIEGSSFATLGSLVEFVESKLAG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt ttggaaaagatggagcgaagcttgaatacagaaaaggaagtgttatctctgctggatgaa atcctgggcttgaaggggcgctcggcagaatttactagtgatacccctcttctcggggcg atcccagagctagattcaatggctgttgttgctctcattactgctcttgaagaacgtttt ggttttgctatagaggacgacgaaattgagggaagttcctttgctacgctgggatctttg gtcgaattcgttgagtctaagctggctggctga

DBGET integrated database retrieval system