Desulforapulum autotrophicum: HRM2_37580 Help Entry HRM2_37580        CDS       T00861                                  Symbol fdx9 Name (GenBank) Fdx9   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dat  Desulforapulum autotrophicum Pathway dat00020   Citrate cycle (TCA cycle) dat00720   Other carbon fixation pathways dat01100   Metabolic pathways dat01110   Biosynthesis of secondary metabolites dat01120   Microbial metabolism in diverse environments dat01200   Carbon metabolism dat01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dat00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     HRM2_37580 (fdx9)   09102 Energy metabolism    00720 Other carbon fixation pathways     HRM2_37580 (fdx9) Enzymes [BR:dat01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      HRM2_37580 (fdx9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_7 Fer4_9 Fer4_21 Fer4_2 Fer4_16 Fer4_4 Fer4_8 Fer4_6 Fer4_17 Fer4_ETF_QO Fer4_3 Fer4_22 Fer4_13 Fer4_15 Motif Other DBs NCBI-ProteinID:  ACN16816 UniProt:  C0QAN3 LinkDB All DBs Position complement(4216586..4216807) Genome browser AA seq 73 aa AA seqDB search MARLKLKEHLINREWCKGCGICVHFCPKQVLELDAMEKVVVARPEDCICCKLCELRCPDL AIEVLTDQDEKNE NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggccagactgaaactaaaggaacatttgataaatcgggagtggtgcaaggggtgtgga atctgcgtccatttctgtccgaaacaggtgctggaactcgatgccatggaaaaggtggtt gtggcaaggcccgaggattgtatctgctgtaaactgtgtgagctcaggtgtcctgatctt gccattgaagtgttaaccgaccaggatgagaaaaatgaataa

DBGET integrated database retrieval system