KEGG   Candidatus Desulforudis audaxviator: Daud_1546
Entry
Daud_1546         CDS       T00655                                 
Name
(GenBank) ABC transporter related
  KO
K09817  zinc transport system ATP-binding protein [EC:7.2.2.20]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:dau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Daud_1546
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dau02000]
    Daud_1546
Enzymes [BR:dau01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.20  ABC-type Zn2+ transporter
     Daud_1546
Transporters [BR:dau02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Zinc transporter
    Daud_1546
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 AAA_25 AAA_22 AAA_16 AAA_15 AAA_30 AAA_29 AAA_33 nSTAND3 NACHT AAA_27 Thymidylate_kin Mg_chelatase AAA NB-ARC TsaE AAA_24 AAA_13 AAA_28
Other DBs
NCBI-ProteinID: ACA60048
UniProt: B1I4Y0
LinkDB
Position
1631446..1632192
AA seq 248 aa
MVVSLEEVSVSIRGVRVLDGIDLEVAEGAFVAVIGPNGAGKTTLARVILGLVRPDSGRVL
LFGKPPNGPQNRKHLVGYLPQRQQFDPGFPVSAHDVVMMGRVGCIGLFRFPSRADKDAAT
ETLRRIGFRDTLIGKPIGELSGGQQQLAFLGRALCSHTRLLILDEPTNGLDLVAQRTFYR
VVRELQRNFGLTILVVSHDITSVAGCADEMICLKGSVHARGTAREVLASPGLAEAYGAQP
LGFPARGD
NT seq 747 nt   +upstreamnt  +downstreamnt
gtggtcgtgtccctggaagaagtgagcgtctcgatccggggggtccgggtcctcgacggt
attgacctggaggtggcggagggcgcgtttgtggctgtaatcggccccaacggcgccgga
aagaccaccctggcccgggtgatcctgggtttggtgcgaccggactccggccgggtgctg
ctgttcggcaaaccgccaaacggcccgcagaaccggaagcacctggtgggctacctgccc
cagcggcagcagttcgatccgggttttcccgtttcggcccacgacgtggtgatgatgggc
cgggtgggttgtatcggccttttccgcttcccttcccgggccgacaaggacgcggccacc
gaaaccctgcgccggatcggcttccgggacaccctgatcggcaagcccatcggcgagctg
tccggcggccagcagcagctcgcctttctgggccgggcgttgtgcagccacacccggctt
ttgattctcgacgaaccgaccaacggcctggacctggtggcccagcgcactttctaccgg
gtggtccgggagttgcagcgaaacttcgggctgaccatcctggtcgtctcccacgacatc
accagcgtggccggctgtgcggacgagatgatctgtttgaaaggctccgtgcacgcccgg
ggcaccgcccgggaagtgctggcgagccctgggctggctgaggcttacggcgcccaaccc
cttggatttccggcgcggggggactga

DBGET integrated database retrieval system