Dactylosporangium aurantiacum: Daura_28640 Help Entry Daura_28640       CDS       T08497                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism daur  Dactylosporangium aurantiacum Pathway daur00253   Tetracycline biosynthesis daur01056   Biosynthesis of type II polyketide backbone daur01100   Metabolic pathways daur01110   Biosynthesis of secondary metabolites Module daur_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:daur00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     Daura_28640    00253 Tetracycline biosynthesis     Daura_28640  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:daur01004]     Daura_28640    01008 Polyketide biosynthesis proteins [BR:daur01008]     Daura_28640 Lipid biosynthesis proteins [BR:daur01004]  Polyketide synthase   Component type    Daura_28640 Polyketide biosynthesis proteins [BR:daur01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      Daura_28640     Nonaketide PKS      Daura_28640     Decaketide PKS      Daura_28640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Gal4_dimer Motif Other DBs NCBI-ProteinID:  UWZ50780 UniProt:  A0A9Q9IAD2 LinkDB All DBs Position complement(6419021..6419281) Genome browser AA seq 86 aa AA seqDB search MTGSVLDLAELRRILRIVAGTEQGVDLDADILDTSFSDLGYDSLALLEAAAQILREFGVR LDDDALLEAKSPRQLLDLVSTADSHS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaccggctccgtgctcgatcttgccgaactgcggcgcatcctgcggatcgtcgccggc accgagcagggcgtcgacctcgacgccgacatcctcgacacgtcgttcagcgacctgggc tacgactcgctggcgctgctggaggccgccgcgcagatcctgcgcgagttcggggtccgc ctggacgacgacgcgctgctcgaggcgaagagcccgcgccagctgctggacctggtcagc accgcggacagccactcgtga

DBGET integrated database retrieval system