Dactylosporangium aurantiacum: Daura_37920 Help Entry Daura_37920       CDS       T08497                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism daur  Dactylosporangium aurantiacum Pathway daur00253   Tetracycline biosynthesis daur01056   Biosynthesis of type II polyketide backbone daur01100   Metabolic pathways daur01110   Biosynthesis of secondary metabolites Module daur_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:daur00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     Daura_37920    00253 Tetracycline biosynthesis     Daura_37920  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:daur01004]     Daura_37920    01008 Polyketide biosynthesis proteins [BR:daur01008]     Daura_37920 Lipid biosynthesis proteins [BR:daur01004]  Polyketide synthase   Component type    Daura_37920 Polyketide biosynthesis proteins [BR:daur01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      Daura_37920     Nonaketide PKS      Daura_37920     Decaketide PKS      Daura_37920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UWZ52393 UniProt:  A0A9Q9IFT0 LinkDB All DBs Position 8566201..8566458 Genome browser AA seq 85 aa AA seqDB search MAQFSIDQLIELLRDSAGEDEAVDLTGDVLDVPFDQLGYDSLALLNTVSRIERDNGIHLS DSVVTDAKTPRLLLDEVNARLGRRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcccagttcagcatcgaccagctcatcgaactgctgcgggacagcgccggcgaggac gaggcggtcgacctgaccggcgacgtgctggacgtgccgttcgaccagctcgggtacgac tcgctggcgctgctcaacaccgtcagccgcatcgagcgggacaacggcatccacctgtcg gactcggtcgtcaccgacgccaagacgccccggctgctgctcgacgaggtcaacgcccgg ctcgggcggcgggcctga

DBGET integrated database retrieval system