Candidatus Desulfofervidus auxilii: HS1_000837 Help Entry HS1_000837        CDS       T09963                                  Name (GenBank) RNA polymerase, omega subunit   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism daw  Candidatus Desulfofervidus auxilii Pathway daw03020   RNA polymerase Brite KEGG Orthology (KO) [BR:daw00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     HS1_000837  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:daw03021]     HS1_000837    03400 DNA repair and recombination proteins [BR:daw03400]     HS1_000837 Enzymes [BR:daw01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      HS1_000837 Transcription machinery [BR:daw03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      HS1_000837 DNA repair and recombination proteins [BR:daw03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       HS1_000837 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  AMM40641 UniProt:  A0A7C1VZJ3 LinkDB All DBs Position complement(830271..830474) Genome browser AA seq 67 aa AA seqDB search MARVTIEDCLKKVNNRFAIVHMAVKRVLQLREGARPLVECDNKEIVVALREIAAGKVKPK TEENGQK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggctagagttacaatagaagattgtttaaaaaaggtaaataatcgttttgccatagtc catatggcagtgaaaagagtgttgcaacttagagaaggggcaagacctttagttgaatgt gataataaagaaattgtagtagcattaagggaaattgccgcaggcaaggtaaaaccaaag accgaggaaaatggccaaaaataa

DBGET integrated database retrieval system