Desulfoglaeba alkanexedens: FDQ92_09915 Help Entry FDQ92_09915       CDS       T05964                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dax  Desulfoglaeba alkanexedens Pathway dax01100   Metabolic pathways dax01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dax00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FDQ92_09915 (acpP)    00074 Mycolic acid biosynthesis     FDQ92_09915 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FDQ92_09915 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DED Motif Other DBs NCBI-ProteinID:  QCQ22448 UniProt:  A0A4P8L3J2 LinkDB All DBs Position 2183156..2183395 Genome browser AA seq 79 aa AA seqDB search MDTNEMRRKVVDIIASQLGVEKDIITPEAHVVDDLGADSLDVVELVMALEEAFDLEIPDE DAENIRTVKDIFDYLEKSL NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggataccaatgaaatgcgtcggaaagtggtggatatcatagcctctcagctgggcgtg gaaaaggacatcattacgcccgaagcgcacgtggtggacgaccttggagccgactccctg gacgtggtcgaactggtcatggccctggaggaagccttcgatctggaaatccccgacgaa gatgcagaaaacattcgcacggtgaaagatatcttcgattacctggaaaagtccctgtga

DBGET integrated database retrieval system