Drosophila arizonae: 108613799 Help Entry 108613799         CDS       T05886                                  Name (RefSeq) autophagy protein 12-like   KO K08336   ubiquitin-like protein ATG12 Organism daz  Drosophila arizonae Pathway daz04068   FoxO signaling pathway daz04136   Autophagy - other daz04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:daz00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     108613799  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108613799    04136 Autophagy - other     108613799  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:daz04131]     108613799    04121 Ubiquitin system [BR:daz04121]     108613799    03029 Mitochondrial biogenesis [BR:daz03029]     108613799 Membrane trafficking [BR:daz04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     108613799 Ubiquitin system [BR:daz04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    108613799 Mitochondrial biogenesis [BR:daz03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     108613799 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 Cmc1 Motif Other DBs NCBI-GeneID:  108613799 NCBI-ProteinID:  XP_017863013 LinkDB All DBs Position 4 AA seq 114 aa AA seqDB search MTDTEEPQAPTTTSTTSVAAPPDKDSAKICILLNATGNVPIIKKRTWTVDPNKTVSWIQK FIHKFLKLDANEQIFLYVNQTFAPAPDQIIKNLYECHGTNGKLVLYYCKNQAWG NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgacggacacggaggaaccgcaagctcccacaacaacatcaacgacatccgttgcagca ccccccgacaaggattcagcaaaaatttgcattctgctaaacgcaactggcaacgtgccc attataaagaaacgcacatggaccgttgatcccaacaaaacagtcagttggatacagaag tttatacacaaattcctcaaactcgatgccaacgaacaaatttttttatatgtaaatcaa acatttgcacctgcgccggaccagatcatcaaaaacctgtacgaatgccacggtaccaat ggtaaattggttttatactattgcaagaatcaagcatggggctaa

DBGET integrated database retrieval system