Drosophila arizonae: 108613858 Help Entry 108613858         CDS       T05886                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism daz  Drosophila arizonae Pathway daz04013   MAPK signaling pathway - fly daz04145   Phagosome daz04148   Efferocytosis daz04310   Wnt signaling pathway daz04620   Toll-like receptor signaling pathway daz05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:daz00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     108613858    04310 Wnt signaling pathway     108613858  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108613858    04148 Efferocytosis     108613858  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108613858  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     108613858  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:daz04131]     108613858   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:daz04147]     108613858    04031 GTP-binding proteins [BR:daz04031]     108613858 Membrane trafficking [BR:daz04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     108613858  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     108613858   Macropinocytosis    Ras GTPases     108613858  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     108613858 Exosome [BR:daz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108613858   Exosomal proteins of other body fluids (saliva and urine)    108613858   Exosomal proteins of colorectal cancer cells    108613858   Exosomal proteins of bladder cancer cells    108613858 GTP-binding proteins [BR:daz04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     108613858 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  108613858 NCBI-ProteinID:  XP_017863107 LinkDB All DBs Position 4 AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR DDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPV LQPKSKRKCALL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgattaagtgtgtcgtcgtgggtgatggtgctgtgggtaagacatgcctgctc atcagctatacgacaaatgcgtttcccggcgagtatattcccaccgtctttgacaactat tccgccaatgtgatggttgacgcgaagcccattaatttgggcttgtgggatacggccggc caggaggattatgatcgcttgcggccattgtcgtatccacagaccgatgtcttcctcatt tgcttctcgctggtaaatccagcctcgttcgagaacgtgcgagctaaatggtatccagag gtgcgtcatcattgccccagcacaccaatcatattggtgggcaccaagctggatttgcgc gacgataagaatacaattgagaagctgcgtgacaagaagctcgcgcccatcacataccca cagggtttggccatggcgaaggaaatcggagctgttaaatatttggaatgttcggcactg acgcaaaagggcctgaagaccgtcttcgatgaggctattagatcggtgctctgtcccgtt ctgcagcccaaatccaagcgcaaatgcgctctgctttaa

DBGET integrated database retrieval system