Drosophila arizonae: 108619038
Help
Entry
108619038 CDS
T05886
Name
(RefSeq) ADP-ribosylation factor-related protein 1
KO
K07952
ADP-ribosylation factor related protein 1
Organism
daz
Drosophila arizonae
Brite
KEGG Orthology (KO) [BR:
daz00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
daz04131
]
108619038
09183 Protein families: signaling and cellular processes
04031 GTP-binding proteins [BR:
daz04031
]
108619038
Membrane trafficking [BR:
daz04131
]
Endosome - Golgi transport
Arf GTPases and associated proteins
Arf GTPases
108619038
GTP-binding proteins [BR:
daz04031
]
Small (monomeric) G-proteins
Arf/Sar Family
Arp
108619038
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Arf
Ras
Roc
G-alpha
MMR_HSR1
SRPRB
Gtr1_RagA
GTP_EFTU
ATP_bind_1
Motif
Other DBs
NCBI-GeneID:
108619038
NCBI-ProteinID:
XP_017870814
UniProt:
A0ABM1PUC8
LinkDB
All DBs
Position
X
AA seq
200 aa
AA seq
DB search
MYTLLHGFYKYLTQKDEYCVVILGLDNAGKTTYLEAAKTKFTKNYKGLNPAKITTTVGLN
IGTIDVHGVRLNFWDLGGQQELQSLWDKYYQESHGVIYVIDSNDRERMDESKVIFDKMIK
NELLSGVPLLILANKQDLPDVMGVREIKPVFQQAGALIGRRDCLTIPVSALTGEGVDEGI
KWLVEAIKRHSLVRPPREND
NT seq
603 nt
NT seq
+upstream
nt +downstream
nt
atgtacacattgctgcatggcttctacaaatatctcacacagaaagacgagtactgcgtc
gtcattctgggcctggacaacgctggcaaaacgacctatttggaggcggccaaaacgaaa
tttacgaaaaattacaaagggctgaatccggctaaaatcacaacgacagtcggtctcaac
attggcaccatcgatgtccacggcgtccgattgaatttctgggatttgggtggccagcag
gaattgcagtcgctgtgggacaaatactatcaggaatcgcatggcgttatttatgtgata
gattccaatgatcgggaacgaatggacgagtcgaaagttatttttgacaaaatgattaag
aacgagctactctcaggcgtaccactgctaatactggccaacaagcaggatctgcccgat
gtgatgggcgtacgggaaataaagccagtattccaacaggctggtgcactgatcggacga
cgcgattgccttacgatacccgtctctgcgctcaccggcgaaggcgttgacgagggcatc
aaatggctggtggaggcgatcaagcgacattccttagtgcgtccgccgcgagaaaacgat
tga
DBGET
integrated database retrieval system